PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.158340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 310aa    MW: 34495.8 Da    PI: 7.9258
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.158340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
   Cucsa.158340.1 16 KGPWTPEEDIVLVSYIQQHGPGNWRAVPSNTGLLRCSKSCRLRWTNYL 63
                     79******************************99************97 PP

2Myb_DNA-binding49.97.3e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
   Cucsa.158340.1  69 RGNFTDQEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 114
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-24766IPR009057Homeodomain-like
PROSITE profilePS5129417.5621163IPR017930Myb domain
SuperFamilySSF466894.77E-3013110IPR009057Homeodomain-like
SMARTSM007176.6E-141565IPR001005SANT/Myb domain
PfamPF002491.5E-151663IPR001005SANT/Myb domain
CDDcd001677.13E-101863No hitNo description
PROSITE profilePS5129424.21664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2467118IPR009057Homeodomain-like
SMARTSM007173.0E-1568116IPR001005SANT/Myb domain
PfamPF002491.4E-1469114IPR001005SANT/Myb domain
CDDcd001671.00E-971114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
KIMGRPPCCD KEGVKKGPWT PEEDIVLVSY IQQHGPGNWR AVPSNTGLLR CSKSCRLRWT  60
NYLRPGIKRG NFTDQEEKMI VHLQALLGNR WAAIASYLPQ RTDNDIKNYW NTHLKKKLRK  120
VQVRSNSYGD TSKQGMARGQ WEKRLQTDIR MARQALWEAL TPQTSTTDFS ELLLNPSSLG  180
CFSTKQAQAQ AQAQAQAQAQ TQAQATAYAS STENIAKLLT GWMKTPAKTE VKTESSGGSG  240
GDGGGDGEFR SILRYECYEN GNTCENHEEG MNCEGLPFSM IEKWLLEESG GAQPRDCELN  300
DIGILDENI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-26161184105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-251411825128MYB TRANSFORMING PROTEIN
1mse_C8e-26161184105C-Myb DNA-Binding Domain
1msf_C8e-26161184105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818891e-135LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132631e-135LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011655993.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU71e-109MYB30_ARATH; Transcription factor MYB30
TrEMBLQ2HVT21e-112Q2HVT2_MEDTR; Homeodomain-related
STRINGAT3G28910.11e-106(Arabidopsis thaliana)
STRINGGLYMA18G49360.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-103myb domain protein 30